HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GTE2

Names and origin
Entry : E3GTE2 (unreviewed)
Entry name : E3GTE2_HAEI2
Protein names : Putative fluoride ion transporter CrcB
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : crcB
ORF names : R2846_1735
History
Date of creation : 2011-01-11
Date of modification : 2013-11-13
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : inorganic anion transmembrane transporter activity; inorganic anion transport; integral to plasma membrane
GO identifier : GO:0015103; GO:0015698; GO:0005887
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to CrcB (TC 9.B.71) family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 140 residues
>E3GTE2|E3GTE2_HAEI2 Haemophilus influenzae R2846
MQALLFISYGAILGASLRWAIGLLFNPLFSSFAFGTLIANLFGCLIIGVLLGLFWQFPQI
SSEWRLFLITGFLGSLTTFSSFSSEVVELFFNDKWLNGFCVLMMHLFGCLAMTVLGIWIY
KICSQLLS