HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GTE1

Names and origin
Entry : E3GTE1 (unreviewed)
Entry name : E3GTE1_HAEI2
Protein names : Regulatory protein RecX
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : recX
ORF names : R2846_1734
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; regulation of DNA repair
GO identifier : GO:0005737; GO:0006282
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm
General annotation
Sequence similarities : Belongs to RecX family
Subcellular location : Cytoplasm.
Protein sequence
Length : 164 residues
>E3GTE1|E3GTE1_HAEI2 Haemophilus influenzae R2846
MSSLAFNYIVNLLSRREYSEFELRNKMQEKNFSEEEIDEALSRCQAKNWQSDRRFSENYL
NSRVQKGYGVGRIRQELRQLKGVSSDIIDEVLMESEIDWYEMAENLLRKKFPNYNEQQTP
KMKQKIWQYMLSHGFRSDEFADLIGQNQSEWD