HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GTB6

Names and origin
Entry : E3GTB6 (unreviewed)
Entry name : E3GTB6_HAEI2
Protein names : 50S ribosomal protein L7/L12
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpL7
ORF names : rplL
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L7/L12P family
Protein sequence
Length : 135 residues
>E3GTB6|E3GTB6_HAEI2 Haemophilus influenzae R2846
MSLTNEQIIEAIASKTVTEIVELIAAMEEKFGVSAAAAVAAAPAAGGAAAAEEKTEFDVV
LKSAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGVSKEEAEALKKELEEAGAEV
EVK