HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GT86

Names and origin
Entry : E3GT86 (unreviewed)
Entry name : E3GT86_HAEI2
Protein names : Cell division protein ZapB
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : zapB
ORF names : R2846_1666
History
Date of creation : 2011-01-11
Date of modification : 2013-11-13
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytokinesis by binary fission; cytoplasm
GO identifier : GO:0000917; GO:0043093; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Coiled coil; Complete proteome; Cytoplasm; Septation
General annotation
Sequence similarities : Belongs to ZapB family
Subcellular location : Cytoplasm.
Protein sequence
Length : 80 residues
>E3GT86|E3GT86_HAEI2 Haemophilus influenzae R2846
MSLEILDQLEEKIKQAVETIQLLQLEVEELKEKNAESQRNIENLQTENEQLKNEHRNWQE
HIRSLLGKFDNV