HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GT84

Names and origin
Entry : E3GT84 (unreviewed)
Entry name : E3GT84_HAEI2
Protein names : D-tyrosyl-tRNA(Tyr) deacylase (EC 3.1.-.-)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : dtd
ORF names : R2846_1664
EC number : 3.1.-.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : D-amino acid catabolic process; cytoplasm; hydrolase activity, acting on ester bonds
GO identifier : GO:0019478; GO:0005737; GO:0016788
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Hydrolase
General annotation
Sequence similarities : Belongs to DTD family
Subcellular location : Cytoplasm.
Protein sequence
Length : 156 residues
>E3GT84|E3GT84_HAEI2 Haemophilus influenzae R2846
MIALIQRVSQAKVDVNGETIGKIGKGLLVLLGVEKEDNREKADKLAEKVLNYRIFSDEND
KMNLNVQQAQGELLIVSQFTLAADTQKGLRPSFSKGAPPALANELYEYFIQKCAEKLPVS
TGQFAADMQVSLTNDGPVTFWLNV