HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E3GT69

Names and origin

Entry	:	E3GT69 (unreviewed)
Entry name	:	E3GT69_HAEI2
Protein names	:	50S ribosomal protein L19
Organism	:	Haemophilus influenzae R2846
Organism ID	:	262727
Gene names	:	rpL19
ORF names	:	rplS

History

Date of creation	:	2011-01-11
Date of modification	:	2013-10-16
Date of sequence modification	:	2011-01-11

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

Complete proteome; Ribonucleoprotein; Ribosomal protein

General annotation

Sequence similarities

Belongs to Ribosomal protein L19P family

Protein sequence

Length

124 residues

>E3GT69|E3GT69_HAEI2 Haemophilus influenzae R2846
MSNIIKQLEQEQLKQNVPSFRPGDTLEVKVWVVEGSKRRLQAFEGVVIAIRNRGLHSAFT
LRKVSNGVGVERVFQTHSPAVDSIAVKRKGAVRKAKLYYLRERSGKSARIKERLGA