HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GT66

Names and origin
Entry : E3GT66 (unreviewed)
Entry name : E3GT66_HAEI2
Protein names : 30S ribosomal protein S16
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpS16
ORF names : rpsP
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein S16P family
Protein sequence
Length : 90 residues
>E3GT66|E3GT66_HAEI2 Haemophilus influenzae R2846
MVTIRLSRGGAKKRPFYQIVVADSRSPRDGRFIERVGFFNPIAQGNAERLRINLERVNHW
VAQGASLSDRVASLVKEAQKAA