HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GT26

Names and origin
Entry : E3GT26 (unreviewed)
Entry name : E3GT26_HAEI2
Protein names : Protein PsiE homolog
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : psiE
ORF names : R2846_0387
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cellular response to phosphate starvation; integral to membrane; plasma membrane
GO identifier : GO:0016036; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to PsiE family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 151 residues
>E3GT26|E3GT26_HAEI2 Haemophilus influenzae R2846
MEESPELEKLPRIITDVLKIVLCTALIVLAIVLIIALVKITYTLSMMVLNTSSVVPYDVA
EQAVMFFLYFGFIGLIVQYFKSGYHFPLRYFIYAGITAMLRLIIVNHESSMDTILFAGAI
LIMVIALCLVLYSNKLKNI