HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GT10

Names and origin
Entry : E3GT10 (unreviewed)
Entry name : E3GT10_HAEI2
Protein names : Putative oxidoreductase
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yfgD
ORF names : R2846_0365
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : arsenate reductase (glutaredoxin) activity
GO identifier : GO:0008794
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 124 residues
>E3GT10|E3GT10_HAEI2 Haemophilus influenzae R2846
MSVIIYHNPHCSKSRETLALLENKGIQPIIELYLQKQYSVNELQSIAKKLGIDDVRQMMR
TKDELYKSLNLDNLDLSQAELFKAISEHSALIERPIVINGDKAKIGRPPETVLEIL