HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GT04

Names and origin
Entry : E3GT04 (unreviewed)
Entry name : E3GT04_HAEI2
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
ORF names : R2846_1650
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 51 residues
>E3GT04|E3GT04_HAEI2 Haemophilus influenzae R2846
MNNENMVRVFYVLLMGLGFPIMRFMSIHFETLNNNSVRFLSGGLLFA