HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSW4

Names and origin
Entry : E3GSW4 (unreviewed)
Entry name : E3GSW4_HAEI2
Protein names : Sulfurtransferase TusA homolog (EC 2.8.1.-)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : sirA
ORF names : tusA
EC number : 2.8.1.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; sulfurtransferase activity
GO identifier : GO:0005737; GO:0016783
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Transferase
General annotation
Sequence similarities : Belongs to UPF0033 family, TusA subfamily
Subcellular location : Cytoplasm.
Protein sequence
Length : 87 residues
>E3GSW4|E3GSW4_HAEI2 Haemophilus influenzae R2846
MSEISVTQTLDTLGLRCPEPVMLVRKNIRHLNDGEILLIIADDPATTRDIPSFCQFMDHT
LLQSEVEKPPFKYWVKRGK