HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSV7

Names and origin
Entry : E3GSV7 (unreviewed)
Entry name : E3GSV7_HAEI2
Protein names : Protein CyaY
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : cyaY
ORF names : R2846_1597
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ferric iron binding; iron-sulfur cluster assembly
GO identifier : GO:0008199; GO:0016226
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to Frataxin family
Protein sequence
Length : 109 residues
>E3GSV7|E3GSV7_HAEI2 Haemophilus influenzae R2846
MNIAEFHQNIEQVWQKIEEELENQGADVDCETQGSVFTITFDNRTQIVINKQEPLLELWI
ASKLGGFHFAFKNGDWVSNDGQRFWDCFVEACAAHGENVQF