HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSU3

Names and origin
Entry : E3GSU3 (unreviewed)
Entry name : E3GSU3_HAEI2
Protein names : Protein-export protein SecB
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : secB
ORF names : R2846_1583
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; protein folding; protein tetramerization; protein transport
GO identifier : GO:0005737; GO:0006457; GO:0051262; GO:0015031
Keywords
Ligand & Biological process : Chaperone; Complete proteome; Cytoplasm; Protein transport; Translocation; Transport
General annotation
Sequence similarities : Belongs to SecB family
Subcellular location : Cytoplasm.
Protein sequence
Length : 181 residues
>E3GSU3|E3GSU3_HAEI2 Haemophilus influenzae R2846
MSEQKQDVAATEEQQPVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGD
NLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYAR
ELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAEEKPEEEQTKH