HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSR3

Names and origin
Entry : E3GSR3 (unreviewed)
Entry name : E3GSR3_HAEI2
Protein names : Probable transcriptional regulator ArsR
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : arsR
ORF names : R2846_0342
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Transcription; Transcription regulation
General annotation
Domains : HTH arsR-type DNA-binding domain (1)
Protein sequence
Length : 108 residues
>E3GSR3|E3GSR3_HAEI2 Haemophilus influenzae R2846
MNTIQASKLFESLSSPIRLAIFQQLTAAGSTGMIAGDLAKQLNLAPNNVSFHLKSLLHSG
LVRVVQEGRHMRYFAELDLMMALTHFLTQNCCSQTGESCQ