HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSR0

Names and origin
Entry : E3GSR0 (unreviewed)
Entry name : E3GSR0_HAEI2
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
ORF names : R2846_0339
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : regulation of transcription, DNA-dependent
GO identifier : GO:0006355
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 80 residues
>E3GSR0|E3GSR0_HAEI2 Haemophilus influenzae R2846
MQMNKLTAGRPSATKSKLSVADVSEQERIKRISFDMTEANHRELKKYAAEQGVTIREVLN
GLIDELLAKKKK