HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSQ4

Names and origin
Entry : E3GSQ4 (unreviewed)
Entry name : E3GSQ4_HAEI2
Protein names : Biopolymer transport protein ExbB
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : exbB
ORF names : R2846_0333
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; protein transporter activity
GO identifier : GO:0016021; GO:0008565
Keywords
Ligand & Biological process : Complete proteome; Membrane; Protein transport; Transmembrane; Transport
General annotation
Sequence similarities : Belongs to ExbB/tolQ family
Subcellular location : Membrane; Multi-pass membrane protein.
Protein sequence
Length : 162 residues
>E3GSQ4|E3GSQ4_HAEI2 Haemophilus influenzae R2846
MVQLFDFLQQYSDYFIIGLLLLMSIIMLAMVIERYLFLRKVSVAHYSTIHALDIDLNRNM
TVISTIGANAPYVGLLGTVIGILLTFYQIGHGGGDIDPSVIMLHLSLALKATALGILVAI
PSMVFYNGLGRKVEVNRLKWKVLSEQKDKE