HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSQ0

Names and origin
Entry : E3GSQ0 (unreviewed)
Entry name : E3GSQ0_HAEI2
Protein names : Ribosome binding protein Y
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yfiA
ORF names : R2846_0329
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : primary metabolic process
GO identifier : GO:0044238
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 115 residues
>E3GSQ0|E3GSQ0_HAEI2 Haemophilus influenzae R2846
MTLNITSKQMDITPAIREHLEERLAKLGKWQTQLISPHFVLNKVPNGFTVEASIGTPLGN
LLASATSDDMYKAINEVEEKLERQLNKLQHKSESRRANERLKDSFEN