HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSL6

Names and origin
Entry : E3GSL6 (unreviewed)
Entry name : E3GSL6_HAEI2
Protein names : Copper chaperone protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : copZ2
ORF names : copZ3
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : metal ion binding; metal ion transport
GO identifier : GO:0046872; GO:0030001
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 76 residues
>E3GSL6|E3GSL6_HAEI2 Haemophilus influenzae R2846
MKTITLNIKGIHCGCCVKSLTQVLTELDGVQSADVQLEGKVNITFDENRVNVAQLIEVIE
DAGFDATE