HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSK4

Names and origin
Entry : E3GSK4 (unreviewed)
Entry name : E3GSK4_HAEI2
Protein names : 50S ribosomal protein L31
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpL31
ORF names : rpmE
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : metal ion binding; rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0046872; GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Metal-binding; RNA-binding; Ribonucleoprotein; Ribosomal protein; Zinc; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L31P family, Type A subfamily
Protein sequence
Length : 78 residues
>E3GSK4|E3GSK4_HAEI2 Haemophilus influenzae R2846
MKQGIHPEYKEITATCSCGNVIKTRSTLGKDINLDVCGNCHPFYTGKQRVVDTGGRVERF
NSRFKIPSTK