HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSK2

Names and origin
Entry : E3GSK2 (unreviewed)
Entry name : E3GSK2_HAEI2
Protein names : Probable Fe(2+)-trafficking protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yggX
ORF names : R2846_1565
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : iron ion binding
GO identifier : GO:0005506
Keywords
Ligand & Biological process : Complete proteome; Iron
General annotation
Sequence similarities : Belongs to Fe(2+)-trafficking protein family
Protein sequence
Length : 98 residues
>E3GSK2|E3GSK2_HAEI2 Haemophilus influenzae R2846
MARTVFCEYLKKEAEGLDFQLYPGELGKRIFDSVSKQAWGEWIKKQTMLVNEKKLNMMNA
EHRKLLEQEMVNFLFEGKDVHIEGYVPPSN