HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSI5

Names and origin
Entry : E3GSI5 (unreviewed)
Entry name : E3GSI5_HAEI2
Protein names : 50S ribosomal protein L22
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpL22
ORF names : rplV
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : large ribosomal subunit; rRNA binding; structural constituent of ribosome; translation
GO identifier : GO:0015934; GO:0019843; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L22P family
Protein sequence
Length : 118 residues
>E3GSI5|E3GSI5_HAEI2 Haemophilus influenzae R2846
METIAKHRYARTSAQKARLVADLIRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSDR