HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSH3

Names and origin
Entry : E3GSH3 (unreviewed)
Entry name : E3GSH3_HAEI2
Protein names : 50S ribosomal protein L18
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpL18
ORF names : rplR
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L18P family
Protein sequence
Length : 125 residues
>E3GSH3|E3GSH3_HAEI2 Haemophilus influenzae R2846
MDKKSARIRRAARARHMMREQGVTRLVIHRTPRHIYAQVIAPNGSEVLAAASTVEKAIRE
QVKYTGNKDAAAAVGKAVAERALAKGVQAVAFDRSGFKYHGRVQTLADAAREAGLQF