HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSG6

Names and origin
Entry : E3GSG6 (unreviewed)
Entry name : E3GSG6_HAEI2
Protein names : 30S ribosomal protein S11
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpS11
ORF names : rpsK
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein S11P family
Protein sequence
Length : 141 residues
>E3GSG6|E3GSG6_HAEI2 Haemophilus influenzae R2846
MAKTPVRARKRVKKQVVDGVAHIHASFNNTIVTITDRQGNALAWATAGGSGFRGSRKSTP
FAAQVAAERCAEIVKEFGLKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG
CRPPKKRRV