HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSF3

Names and origin
Entry : E3GSF3 (unreviewed)
Entry name : E3GSF3_HAEI2
Protein names : Carbon storage regulator homolog
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : csrA
ORF names : R2846_1514
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; mRNA catabolic process; regulation of carbohydrate metabolic process
GO identifier : GO:0003723; GO:0006402; GO:0006109
Keywords
Ligand & Biological process : Complete proteome; RNA-binding
General annotation
Sequence similarities : Belongs to CsrA family
Protein sequence
Length : 71 residues
>E3GSF3|E3GSF3_HAEI2 Haemophilus influenzae R2846
MLILTRKVGESVLIGDDISITVLSVRGNQVKLGVEAPKEVSVHREEIYQRIKQTKDEPYL
GSS