HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSF1

Names and origin
Entry : E3GSF1 (unreviewed)
Entry name : E3GSF1_HAEI2
Protein names : Universal stress protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : uspA
ORF names : R2846_1512
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; response to stress
GO identifier : GO:0005737; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm
General annotation
Sequence similarities : Belongs to Universal stress protein A family
Subcellular location : Cytoplasm.
Protein sequence
Length : 153 residues
>E3GSF1|E3GSF1_HAEI2 Haemophilus influenzae R2846
MYKHILVAVDLSEESPILLKKAVGIAKRHDAKLSIIHVDVNFSDLYTGLIDVNMSSMQDR
ISTETQKALLDLAESVDYPISEKLSGSGDLGQVLSDAIEQYDVDLLVTGHHQDFWSKLMS
STRQVMNTIKIDMLVVPLRDE