HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSE0

Names and origin
Entry : E3GSE0 (unreviewed)
Entry name : E3GSE0_HAEI2
Protein names : Probable intracellular septation protein A
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ispA2
ORF names : ispZ
History
Date of creation : 2011-01-11
Date of modification : 2013-06-26
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; integral to membrane; plasma membrane
GO identifier : GO:0000917; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell cycle; Cell division; Cell inner membrane; Cell membrane; Complete proteome; Membrane; Septation; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to YciB family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 201 residues
>E3GSE0|E3GSE0_HAEI2 Haemophilus influenzae R2846
MKQLLDFIPLILFFITYKLGGVREAAIVLVVATILQIVILKWKYGIVEKQQKIMASAVVF
FGLLTAYFNEIRYLQWKVTIINGLFAIVLLVAQFQFKTPLIKKLLGKELQLPEKAWNTLN
FGWAIFFIICMLVNIYISHNMSEEAWVDFKSFGIIGMTVIATIISGVYIYRYLPKDGSNS
KDGEK