HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSC5

Names and origin
Entry : E3GSC5 (unreviewed)
Entry name : E3GSC5_HAEI2
Protein names : Putative Holliday junction resolvase (EC 3.1.-.-)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ygqF
ORF names : R2846_0274
EC number : 3.1.-.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA recombination; DNA repair; cytoplasm; nuclease activity; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0006310; GO:0006281; GO:0005737; GO:0004518; GO:0003676; GO:0090305
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA damage; DNA recombination; DNA repair; Hydrolase; Nuclease
General annotation
Sequence similarities : Belongs to YqgF HJR family
Subcellular location : Cytoplasm.
Protein sequence
Length : 151 residues
>E3GSC5|E3GSC5_HAEI2 Haemophilus influenzae R2846
MGITALAFDFGTKSIGCAIGQSITGTAQALPAFKAQDGIPNWEAIEKCLKEWKPDVVIVG
LPLNMDGTEQDLTLRARKFANRLQGRFGVNVHLQDERLTTTQARSEIFERGGFKALKKGK
IDGVSACLILESWFEYAEY