HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSB5

Names and origin
Entry : E3GSB5 (unreviewed)
Entry name : E3GSB5_HAEI2
Protein names : dATP pyrophosphohydrolase (EC 3.6.1.-)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ntpA
ORF names : R2846_0264
EC number : 3.6.1.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA repair; dATP pyrophosphohydrolase activity
GO identifier : GO:0006281; GO:0008828
Keywords
Ligand & Biological process : Complete proteome; Hydrolase
General annotation
Sequence similarities : Belongs to Nudix hydrolase family
Protein sequence
Length : 166 residues
>E3GSB5|E3GSB5_HAEI2 Haemophilus influenzae R2846
MTAFLMMQYKNNQSVLVVIYTKDTNRVLMLQRQDDPDFWQSVTGTIESGETPKKTAIREL
WEEVRLEISENSTALFDCNESIEFEIFPHFRYKYAPNITHCKEHWFLCEVEKEFMPVLSE
HLDFCWISAKKAVEMTKSQNNAEAIKKYLFNLRR