HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GSA8

Names and origin
Entry : E3GSA8 (unreviewed)
Entry name : E3GSA8_HAEI2
Protein names : Ribonuclease T (EC 3.1.13.-) (Exoribonuclease T)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rnt
ORF names : R2846_0257
EC number : 3.1.13.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : exoribonuclease activity, producing 5'-phosphomonoesters; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis; tRNA processing
GO identifier : GO:0016896; GO:0003676; GO:0090305; GO:0008033
Keywords
Ligand & Biological process : Complete proteome; Exonuclease; Hydrolase; Nuclease; tRNA processing
General annotation
Domains : Exonuclease domain (1)
Sequence similarities : Belongs to RNase T family
Protein sequence
Length : 245 residues
>E3GSA8|E3GSA8_HAEI2 Haemophilus influenzae R2846
MSDSQEIPYHNQLKNRFRGYFPVIIDVETAGFDAKKDALLELAAITLKMDENGYLHPDQK
CHFHIEPFEGANINPESLKFNGIDIHNPLRGAVSELDAITGLFQMVRRGQKDADCQRSII
VAHNAAFDQSFVMAAAERTGVKRNPFHPFGMFDTASLAGLMFGQTVLVKACLAAKIPFDG
KQAHSALYDTERTAKLFCYMVNHLKDLGGFPHIASELEQEKTTEKETAL