HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E3GS92

Names and origin

Entry	:	E3GS92 (unreviewed)
Entry name	:	E3GS92_HAEI2
Protein names	:	Glutamine synthetase regulatory protein P-II
Organism	:	Haemophilus influenzae R2846
Organism ID	:	262727
Gene names	:	glnB
ORF names	:	R2846_0240

History

Date of creation	:	2011-01-11
Date of modification	:	2013-10-16
Date of sequence modification	:	2011-01-11

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of catalytic activity; regulation of nitrogen utilization; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier	:	GO:0030234; GO:0050790; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Complete proteome; Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>E3GS92|E3GS92_HAEI2 Haemophilus influenzae R2846
MKKIEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTELYRGAEYMVDFLPKVK
LEVVVPDELVDQCIEAIIETAQTGKIGDGKIFVYNVERAIRIRTGEENEDAI