HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GS82

Names and origin
Entry : E3GS82 (unreviewed)
Entry name : E3GS82_HAEI2
Protein names : Periplasmic nitrate reductase, electron transfer subunit (Diheme cytochrome c NapB)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : napB
ORF names : R2846_0230
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : metal ion binding; oxidation-reduction process; periplasmic space
GO identifier : GO:0046872; GO:0055114; GO:0042597
Keywords
Ligand & Biological process : Complete proteome; Electron transport; Heme; Iron; Metal-binding; Periplasm; Transport
General annotation
Sequence similarities : Belongs to NapB family
Subcellular location : Periplasm.
Protein sequence
Length : 162 residues
>E3GS82|E3GS82_HAEI2 Haemophilus influenzae R2846
MINMTKQVSKILAGLFTALFAGSLMASDAPAVGKDLTQAAENIPPAFHNAPRQGELPALN
YVNQPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKVGSSSSPR
RYFCLQCHVSQANVDPIVPNDFKPMKGYGN