HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GS61

Names and origin
Entry : E3GS61 (unreviewed)
Entry name : E3GS61_HAEI2
Protein names : Fe-S cluster related protein IscX
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : iscX
ORF names : R2846_0209
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : iron-sulfur cluster assembly
GO identifier : GO:0016226
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 72 residues
>E3GS61|E3GS61_HAEI2 Haemophilus influenzae R2846
MKWTDTQLIAEELYDRNPDLDPKTVRFTDLHKWICELEDFDDDPNKSNESILEAILLKWL
DEFE