HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GS60

Names and origin
Entry : E3GS60 (unreviewed)
Entry name : E3GS60_HAEI2
Protein names : [2FE-2S] ferredoxin, electron carrer protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : fdx-1
ORF names : R2846_0208
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; electron carrier activity; metal ion binding
GO identifier : GO:0051537; GO:0009055; GO:0046872
Keywords
Ligand & Biological process : Complete proteome; Iron; Iron-sulfur; Metal-binding
Protein sequence
Length : 121 residues
>E3GS60|E3GS60_HAEI2 Haemophilus influenzae R2846
MPKVIFLPNEDFCPEGMVVDAATGDNLLEVAHNAGVEIHHACDGSCACTTCHVIVREGFD
SLNETSDQEEDMLDKAWGLEMDSRLSCQCVVGNEDLVVEIPKYNLNHANEAAH