HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E3GS56

Names and origin

Entry	:	E3GS56 (unreviewed)
Entry name	:	E3GS56_HAEI2
Protein names	:	Iron-sulfur cluster assembly protein IscA
Organism	:	Haemophilus influenzae R2846
Organism ID	:	262727
Gene names	:	iscA
ORF names	:	R2846_0204

History

Date of creation	:	2011-01-11
Date of modification	:	2013-10-16
Date of sequence modification	:	2011-01-11

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	iron ion binding; iron-sulfur cluster assembly; iron-sulfur cluster binding; structural molecule activity
GO identifier	:	GO:0005506; GO:0016226; GO:0051536; GO:0005198

Keywords

Ligand & Biological process

Complete proteome; Iron; Metal-binding

Protein sequence

Length

115 residues

>E3GS56|E3GS56_HAEI2 Haemophilus influenzae R2846
MGITLTEKAAQRVKAFLDNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFEQHGV
NIIVDPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV