HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GS54

Names and origin
Entry : E3GS54 (unreviewed)
Entry name : E3GS54_HAEI2
Protein names : Fumarate reductase subunit C
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : frdC
ORF names : R2846_1494
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; oxidoreductase activity; plasma membrane
GO identifier : GO:0016021; GO:0016491; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Oxidoreductase; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FrdC family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 148 residues
>E3GS54|E3GS54_HAEI2 Haemophilus influenzae R2846
MSVTVSKRKKYVRPMTATWWQKLDFYKAYMLREATSIFAVWFCIVLLYGVLCLASNPIPG
LGILSFIEFLRNPIVVFLNIVTLIATLYHTVTYFLMTPKVMNIIVKNERLPHTVVRNALW
AVTALVSVIALVLVYI