HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GS47

Names and origin
Entry : E3GS47 (unreviewed)
Entry name : E3GS47_HAEI2
Protein names : UPF0352 protein R2846_1487
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yejL
ORF names : R2846_1487
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0352 family
Protein sequence
Length : 80 residues
>E3GS47|E3GS47_HAEI2 Haemophilus influenzae R2846
MAQHSKYSDAQLSAIVNDMIAVLEKHKAPVDLSLIALGNMASNLLTTSVPQTQREALAQA
FSNSLINAVKTR