HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GS31

Names and origin
Entry : E3GS31 (unreviewed)
Entry name : E3GS31_HAEI2
Protein names : Z-ring associated protein ZapA
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : zapA
ORF names : R2846_1471
History
Date of creation : 2011-01-11
Date of modification : 2013-11-13
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytoplasm
GO identifier : GO:0000917; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Complete proteome; Cytoplasm; Septation
General annotation
Subcellular location : Cytoplasm.
Protein sequence
Length : 108 residues
>E3GS31|E3GS31_HAEI2 Haemophilus influenzae R2846
MSLKLVEILVLGQVLRLNVPIEQEELLRQAARNLDILVSEMKEKTGLIQLDRVLSIVALN
LSFELSQEKNKTAKIEEVLRTGIQQLDHSLENIRVTKEPH