HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GS02

Names and origin
Entry : E3GS02 (unreviewed)
Entry name : E3GS02_HAEI2
Protein names : 50S ribosomal protein L21
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpL21
ORF names : rplU
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L21P family
Protein sequence
Length : 111 residues
>E3GS02|E3GS02_HAEI2 Haemophilus influenzae R2846
MYAVFQSGGKQHRVSEGQVVRLEKLELATGATVEFDSVLMVVNGEDVKIGAPVVAGAKVV
AEVVAQGRGEKVKIVKFRRRKHSRKQQGHRQWFTEVKITGIQA