HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRX6

Names and origin
Entry : E3GRX6 (unreviewed)
Entry name : E3GRX6_HAEI2
Protein names : Transcriptional regulator IscR
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : iscR
ORF names : R2846_0201
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; double-stranded DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0051537; GO:0003690; GO:0046872; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : 2Fe-2S; Activator; Complete proteome; DNA-binding; Iron; Iron-sulfur; Metal-binding; Repressor; Transcription; Transcription regulation
Protein sequence
Length : 162 residues
>E3GRX6|E3GRX6_HAEI2 Haemophilus influenzae R2846
MKLTSKGRYAVTAVLDIALNADGGPVSLADISERQHISLSYLEQLFAKLRKDGLVKSVRG
PGGGYQLGLPSEQISVGMIIAAVNENIHVTKCLGRENCKNGVECLTHELWEDLSLRIESF
LNEITLAELVNKRNVKRQSHRDFSNLLVNQ