HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRX4

Names and origin
Entry : E3GRX4 (unreviewed)
Entry name : E3GRX4_HAEI2
Protein names : Peptidoglycan-associated outer membrane lipoprotein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : pal
ORF names : R2846_0197
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell outer membrane; integral to membrane; plasma membrane
GO identifier : GO:0009279; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Lipoprotein; Membrane
General annotation
Sequence similarities : Belongs to OmpA family
Protein sequence
Length : 165 residues
>E3GRX4|E3GRX4_HAEI2 Haemophilus influenzae R2846
MNKFVKSLLVAGSVAALAACSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDI
TGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDA
GKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY