HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRX1

Names and origin
Entry : E3GRX1 (unreviewed)
Entry name : E3GRX1_HAEI2
Protein names : Outer membrane integrity protein TolR
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : tolR
ORF names : R2846_0194
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; protein transport; transporter activity
GO identifier : GO:0016021; GO:0015031; GO:0005215
Keywords
Ligand & Biological process : Complete proteome; Membrane; Protein transport; Transmembrane; Transport
General annotation
Sequence similarities : Belongs to ExbD/tolR family
Subcellular location : Membrane; Single-pass type II membrane protein.
Protein sequence
Length : 151 residues
>E3GRX1|E3GRX1_HAEI2 Haemophilus influenzae R2846
MARRQRKAIKSEINIVPFLDVLLVLVLIFMATAPIISQSVQVELPDSVQSQEVSNEDKVP
VILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKA
LNLLHLAGIKSVGLMTNPI