HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRV2

Names and origin
Entry : E3GRV2 (unreviewed)
Entry name : E3GRV2_HAEI2
Protein names : DNA mismatch repair protein MutH (Methyl-directed mismatch repair protein)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : mutH
ORF names : R2846_0175
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; DNA modification; DNA repair; cytoplasm; endonuclease activity; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0003677; GO:0006304; GO:0006281; GO:0005737; GO:0004519; GO:0090305
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA damage; DNA repair; Endonuclease; Hydrolase; Nuclease
General annotation
Sequence similarities : Belongs to MutH family
Subcellular location : Cytoplasm.
Protein sequence
Length : 239 residues
>E3GRV2|E3GRV2_HAEI2 Haemophilus influenzae R2846
MIPQTLEQLLSQAQSIAGLTFGELADELHIPVPPDLKRDKGWVGMLLETALGATAGSKAE
QDFSHLGVELKTLPINAEGYPLETTFVSLAPLVQNSGVKWENSHVRHKLSCVLWMPIEGS
RHIPLRERHIGAPIFWKPTAEQERQLKQDWEELMDLIVLGKLEQITARIGEVMQLRPKGA
NSRAVTKGIGKNGEIIDTLPLGFYLRKEFTAQILNAFLETKSL