HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRU4

Names and origin
Entry : E3GRU4 (unreviewed)
Entry name : E3GRU4_HAEI2
Protein names : RNA-binding protein Hfq
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : hfq
ORF names : R2846_0167
History
Date of creation : 2011-01-11
Date of modification : 2013-12-11
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003723; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Stress response
General annotation
Sequence similarities : Belongs to Hfq family
Protein sequence
Length : 99 residues
>E3GRU4|E3GRU4_HAEI2 Haemophilus influenzae R2846
MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS
TVVPARSVSHHNNNHHTAPTETVENVETQAE