HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRS7

Names and origin
Entry : E3GRS7 (unreviewed)
Entry name : E3GRS7_HAEI2
Protein names : DNA-binding protein HU-alpha
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : hupA
ORF names : R2846_0150
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; chromosome condensation
GO identifier : GO:0003677; GO:0030261
Keywords
Ligand & Biological process : Complete proteome; DNA condensation; DNA-binding
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Protein sequence
Length : 98 residues
>E3GRS7|E3GRS7_HAEI2 Haemophilus influenzae R2846
MNKTDLIDAIANAAELNKKQAKAALEATLDAITASLKKGEPVQLIGFGTFKVNERAARTG
RNPQTGAEIQIAASKVPAFVSGKALKDAIK