HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRR5

Names and origin
Entry : E3GRR5 (unreviewed)
Entry name : E3GRR5_HAEI2
Protein names : Nucleoid-associated protein R2846_0138
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : ybaB
ORF names : R2846_0138
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; bacterial nucleoid; cytoplasm
GO identifier : GO:0003677; GO:0043590; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA-binding
General annotation
Sequence similarities : Belongs to YbaB/EbfC family
Subcellular location : Cytoplasm › nucleoid.
Protein sequence
Length : 117 residues
>E3GRR5|E3GRR5_HAEI2 Haemophilus influenzae R2846
MFGKGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPS
LMEDDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF