HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRR2

Names and origin
Entry : E3GRR2 (unreviewed)
Entry name : E3GRR2_HAEI2
Protein names : Protein-export membrane protein SecG
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : secG
ORF names : R2846_0135
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : P-P-bond-hydrolysis-driven protein transmembrane transporter activity; integral to membrane; protein secretion
GO identifier : GO:0015450; GO:0016021; GO:0009306
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 121 residues
>E3GRR2|E3GRR2_HAEI2 Haemophilus influenzae R2846
MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGSAGAGNFLTRTSAILA
TVFFVIALVLGNMNSHKGNVQKGAFDDLSQAAEQVQQQQAAPAKDNKNSDIPQ