HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRQ7

Names and origin
Entry : E3GRQ7 (unreviewed)
Entry name : E3GRQ7_HAEI2
Protein names : Toxin/antitoxin locus vapDX, toxin protein VapD
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : vapD
ORF names : R2846_0129
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 49 residues
>E3GRQ7|E3GRQ7_HAEI2 Haemophilus influenzae R2846
MYAIAFDLVVKDTQDYHPKGVQEAYTDIRAFRIEQWSDFTDFIRN