HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRP5

Names and origin
Entry : E3GRP5 (unreviewed)
Entry name : E3GRP5_HAEI2
Protein names : NTP pyrophosphohydrolase (MutT) (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : mutT
ORF names : R2846_1407
EC number : 3.6.1.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity; DNA repair
GO identifier : GO:0008413; GO:0006281
Keywords
Ligand & Biological process : Complete proteome; Hydrolase
General annotation
Sequence similarities : Belongs to Nudix hydrolase family
Protein sequence
Length : 148 residues
>E3GRP5|E3GRP5_HAEI2 Haemophilus influenzae R2846
MDKKIIQVAAGIIRNEFGQIYLTQRLEGQDFAQSLEFPGGKVDEGETPEQALKRELEEEI
GIVALNAELYERFQFEYPTKIISFFFYLVNEWIGEPFGREGQEGFWVEQRALDAGQFPPA
NAKLIHRLLNETHNFI