HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRL5

Names and origin
Entry : E3GRL5 (unreviewed)
Entry name : E3GRL5_HAEI2
Protein names : Putative thiol-disulfide interchange protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : dsbE2
ORF names : R2846_1375
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cell redox homeostasis; cytochrome complex assembly; disulfide oxidoreductase activity; outer membrane-bounded periplasmic space; oxidation-reduction process
GO identifier : GO:0045454; GO:0017004; GO:0015036; GO:0030288; GO:0055114
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 188 residues
>E3GRL5|E3GRL5_HAEI2 Haemophilus influenzae R2846
MNKKLLFFAPLFVLLGVCILLIAGLNQDPKKIASALIDKPVPEFYQANLLESSQIVSPKD
FPKQPFLLNVWGSWCGYCKEEHPLLIEIAKTLPIVGVDYRDNPQNGIEMLKRMGNPFVLT
INDSHGKLGLKLGVDGAPETYLVDENGVIRYRHSGLLDKETWQTVFLPKIKALKNK