HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GRK7

Names and origin
Entry : E3GRK7 (unreviewed)
Entry name : E3GRK7_HAEI2
Protein names : Transcriptional repressor NrdR
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : nrdR
ORF names : R2846_1367
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; DNA binding; negative regulation of transcription, DNA-dependent; transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0005524; GO:0003677; GO:0045892; GO:0006351; GO:0008270
Keywords
Ligand & Biological process : ATP-binding; Complete proteome; DNA-binding; Metal-binding; Nucleotide-binding; Repressor; Transcription; Transcription regulation; Zinc; Zinc-finger
General annotation
Domains : ATP-cone domain (1)
Sequence similarities : Belongs to NrdR family
Protein sequence
Length : 161 residues
>E3GRK7|E3GRK7_HAEI2 Haemophilus influenzae R2846
MRCPFCDTEETKVIDSRLVSDGYQVRRRRECGHCHERFTTFEMAELIIPKIIKTDGTREP
FNEDKLRSGIQHALEKRPVSADDVEKAINHIILQLRATGEREVPSKLVGKLAMNELKKLD
KVAYIRFASVYLSFDDIDQFTIEIEKLKD